DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and Prss55

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:237 Identity:73/237 - (30%)
Similarity:118/237 - (49%) Gaps:28/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PAYQTRVIGGRVT--TNAKLGGY--LVAMRYFNNFICGGTLIHELIVLTAAHCF-EDRAEKEAWS 97
            |.|.:|:...|:.  ..|:||.:  .|:::..::..|||:::.|..:||.|||| ..........
Mouse    50 PLYDSRIQYSRIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEWWILTVAHCFYAQELSPTDLR 114

  Fly    98 VDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMVGKNIGTLSLCSTALTPG--- 159
            |..|.:.|:...:..:|...|:...||.:.|:.|:|::||.:|:....: |:.:| ..|.|.   
Mouse   115 VRVGTNDLTTSPVELEVTTIIRHKGFKRLNMDNDIALLLLAKPLTFNEL-TVPIC-LPLWPAPPS 177

  Fly   160 -QTMDVSGWGMTN-PDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGKK-DACT 221
             ....|:|||:|| .|.|.....|..|.:.:||...|.:.:   .|::.:|.|||...:. |||.
Mouse   178 WHECWVAGWGVTNSTDKESMSTDLMKVPMRIIEWEECLQMF---PSLTTNMLCASYGNESYDACQ 239

  Fly   222 YDSGGPLV---------YEKQVCGIVSFGIGCASRRYPGVYT 254
            .|||||||         |:   .||:|:|..|..:.:||:||
Mouse   240 GDSGGPLVCTTDPGSRWYQ---VGIISWGKSCGKKGFPGIYT 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 71/232 (31%)
Tryp_SPc 44..265 CDD:238113 70/231 (30%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 70/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.