DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and LOC683849

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:243 Identity:77/243 - (31%)
Similarity:120/243 - (49%) Gaps:37/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSV 98
            :..|.....:::|| .|.......|.|::....:| |||:||::..|::||||::.|.:      
  Rat    14 VAFPVDDDDKIVGG-YTCQENSVPYQVSLNSGYHF-CGGSLINDQWVVSAAHCYKSRIQ------ 70

  Fly    99 DGGISRLSEKGIR--------RQVKRFIKSAQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCST 154
                .||.|..|.        ....:.||...|...|:|.|:.::.|:.|: :...:.|::|.|:
  Rat    71 ----VRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSS 131

  Fly   155 ALTPGQTMDVSGWGMT------NPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASV 213
            ....|....:||||.|      .||      :|:.:..|::.:..|..:|  ...|:|:|.||..
  Rat   132 CAPAGTQCLISGWGNTLSFGVNEPD------LLQCLDAPLLPQADCEASY--PGKITDNMVCAGF 188

  Fly   214 L-GKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDV-HYV 259
            | |.||:|..|||||:|...::.||||:|.|||....|||||.| :||
  Rat   189 LEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 76/234 (32%)
Tryp_SPc 44..265 CDD:238113 76/233 (33%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 76/234 (32%)
Tryp_SPc 24..242 CDD:238113 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.