DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:264 Identity:84/264 - (31%)
Similarity:126/264 - (47%) Gaps:39/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLLFL-FLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRY 64
            ||.|:|| ||.|.:     ||..::..|     |||.....|...:..:|:.|:   ||      
Mouse     1 MKTLIFLAFLGAAV-----ALPLDDDDD-----KIVGGYTCQRNALPYQVSLNS---GY------ 46

  Fly    65 FNNFICGGTLIHELIVLTAAHCFEDR-----AEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFK 124
               ..|||:||:...|::||||::.|     .|....:::||     |:.|  ...:.|:...:.
Mouse    47 ---HFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDALEGG-----EQFI--DAAKIIRHPNYN 101

  Fly   125 MVTMNMDVAVV-LLNRPMVGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPV 188
            ..|.|.|:.:: |.....:...:.|::|..:..:.|....|||||.|.........:|:.:..||
Mouse   102 ANTYNNDIMLIKLKTAATLNSRVSTVALPRSCPSAGTRCLVSGWGNTLSSGTNYPSLLQCLDAPV 166

  Fly   189 IEKRICREAYRESVSISDSMFCASVL-GKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGV 252
            :....|..:|  ...|:.:|||...| |.||:|..|||||:|...|:.|:||:|.|||.|..|||
Mouse   167 LSDSSCTSSY--PGKITSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGV 229

  Fly   253 YTDV 256
            ||.|
Mouse   230 YTKV 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 69/221 (31%)
Tryp_SPc 44..265 CDD:238113 69/220 (31%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 73/231 (32%)
Tryp_SPc 25..243 CDD:238113 72/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.