DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG17234

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:279 Identity:76/279 - (27%)
Similarity:125/279 - (44%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLG----GYLVAMRYFN 66
            ||.|||              :|.....::   ..::.|:|||.     .:|    .:.|:::||.
  Fly     6 FLLLLA--------------LDFLSAGQV---NRWEQRIIGGE-----PIGIEQVPWQVSLQYFG 48

  Fly    67 NFICGGTLIHELIVLTAAHCFED----RAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVT 127
            :.:|||::..|.|::||||||.|    |.:.:.:.|..|.:.....|....|...|...::....
  Fly    49 DHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDL 113

  Fly   128 MNMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWG----MTNPDDEGPGHMLRTVSVP 187
            ...|:|:|.|:.|: ....:..:.|..|...|.....|||||    :.:..:..|.| |:.:::.
  Fly   114 NINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTH-LQGLALH 177

  Fly   188 VIEKRICREAYRESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFG-IGCASRRYPG 251
            :.....||       ....|:.||...| :.||..|||||||..||:.|:||:| .||.|..:  
  Fly   178 IKSIFSCR-------LFDPSLLCAGTYG-RTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF-- 232

  Fly   252 VYTDVHYVKPFIVKGIKAL 270
             :..|.|.:.:|:..|.::
  Fly   233 -FVSVPYFREWILNAIASI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 68/233 (29%)
Tryp_SPc 44..265 CDD:238113 68/234 (29%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 68/233 (29%)
Tryp_SPc 27..243 CDD:238113 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.