DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG34458

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:250 Identity:63/250 - (25%)
Similarity:127/250 - (50%) Gaps:17/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DLKKLAKIVLPPAY---------QTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLT 82
            :|.||:.::|...:         ::|:|||:.....:. .:.|:::......|||:||.:.:::|
  Fly     6 NLVKLSILLLAVTFVHSDMDVAEESRIIGGQFAAPGQF-PHQVSLQLNGRHHCGGSLISDTMIVT 69

  Fly    83 AAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPM-VGKNI 146
            ||||...:...:..::.|.....:..|....:.:||...::...:.:.|::::.|:.|: :|..:
  Fly    70 AAHCTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAV 134

  Fly   147 GTLSLC-STALTPGQTMD-VSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMF 209
            .|:.|. |.:.....||. :||:|..|.:.:.| :.|:...|.:..:..|..  :....::|.|.
  Fly   135 QTIQLADSDSNYAADTMAMISGFGAINQNLQLP-NRLKFAQVQLWSRDYCNS--QNIPGLTDRMV 196

  Fly   210 CAS-VLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPFI 263
            ||. ..|:..:|..||||||..:.::.|:||:|.||.::..|.:||.|..::.:|
  Fly   197 CAGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 58/223 (26%)
Tryp_SPc 44..265 CDD:238113 57/223 (26%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 58/223 (26%)
Tryp_SPc 32..254 CDD:238113 57/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.