DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and PRSS3

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:243 Identity:79/243 - (32%)
Similarity:128/243 - (52%) Gaps:37/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSV 98
            :.:|.....:::||.......| .|.|::...::| |||:||.|..|::||||::.|.:      
Human   100 VAVPFDDDDKIVGGYTCEENSL-PYQVSLNSGSHF-CGGSLISEQWVVSAAHCYKTRIQ------ 156

  Fly    99 DGGISRLSEKGIR--RQVKRFIKSA------QFKMVTMNMDVAVVLLNRP-MVGKNIGTLSLCST 154
                .||.|..|:  ...::||.:|      ::...|::.|:.::.|:.| ::...:.|:||.:|
Human   157 ----VRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTT 217

  Fly   155 ALTPGQTMDVSGWGMT------NPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASV 213
            ....|....:||||.|      .||:      |:.:..||:.:..|:.:|  ...|::||||...
Human   218 PPAAGTECLISGWGNTLSFGADYPDE------LKCLDAPVLTQAECKASY--PGKITNSMFCVGF 274

  Fly   214 L-GKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVH-YV 259
            | |.||:|..|||||:|...|:.|:||:|.|||.:..|||||.|: ||
Human   275 LEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 78/234 (33%)
Tryp_SPc 44..265 CDD:238113 78/233 (33%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 78/234 (33%)
Tryp_SPc 110..328 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.