DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and PRSS1

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:256 Identity:80/256 - (31%)
Similarity:124/256 - (48%) Gaps:57/256 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AKIVLPPAYQTRVIGG----------RVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHC 86
            |.:..|.....:::||          :|:.|:   ||         ..|||:||:|..|::|.||
Human   237 AALAAPFDDDDKIVGGYNCEENSVPYQVSLNS---GY---------HFCGGSLINEQWVVSAGHC 289

  Fly    87 FEDRAEKEAWSVDGGISRLSEKGIR--RQVKRFIKSA------QFKMVTMNMDVAVV-LLNRPMV 142
            ::.|.:          .||.|..|.  ...::||.:|      |:...|:|.|:.:: |.:|.::
Human   290 YKSRIQ----------VRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVI 344

  Fly   143 GKNIGTLSLCSTALTPGQTMDVSGWGMT------NPDDEGPGHMLRTVSVPVIEKRICREAYRES 201
            ...:.|:||.:.....|....:||||.|      .||:      |:.:..||:.:..|..:|  .
Human   345 NARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDE------LQCLDAPVLSQAKCEASY--P 401

  Fly   202 VSISDSMFCASVL-GKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVH-YVK 260
            ..|:.:|||...| |.||:|..|||||:|...|:.|:||:|.|||.:..|||||.|: |||
Human   402 GKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVK 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 78/245 (32%)
Tryp_SPc 44..265 CDD:238113 78/244 (32%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 78/245 (32%)
Tryp_SPc 249..467 CDD:238113 78/244 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.