DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and Prss53

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:205 Identity:66/205 - (32%)
Similarity:93/205 - (45%) Gaps:25/205 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMV 126
            :::.....|||.|:.|::||||||||..|...|.|||..|... .|.|:    |:.|....:...
  Rat   357 LKHHGKLACGGALVSEVVVLTAAHCFIGRQTLEEWSVGLGAGP-EEWGL----KQLILHGAYTHP 416

  Fly   127 TMNMDVAVVLLNRPM-VGKNIGTLSL--CSTALTPGQTMDVSGW--GMTNPDDEGPGHMLRTVSV 186
            ....|||.:||.:|: :|..:..|.|  ....|..|:    .||  |:|.  :.|..|. .||.|
  Rat   417 EGGHDVAFLLLAQPVTLGPGLRPLCLPYADHRLPDGE----HGWVLGLTR--EAGINHP-HTVPV 474

  Fly   187 PVIEKRICREAYRES----VSISDSMFCASVLGKKDACTYDSGGPLVYEKQ----VCGIVSFGIG 243
            .|:....|...:..|    |.|...|.|.:|:|:...|...||.|||:|.:    :.|:.|||..
  Rat   475 TVLGPMACSRQHAASGSTGVPILPGMICTTVVGEPPHCEGLSGAPLVHEIRGTWFLAGLHSFGDT 539

  Fly   244 CASRRYPGVY 253
            |.....|.|:
  Rat   540 CQGSAKPAVF 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 66/205 (32%)
Tryp_SPc 44..265 CDD:238113 66/205 (32%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 66/205 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.