Sequence 1: | NP_649270.1 | Gene: | Sems / 40315 | FlyBaseID: | FBgn0037036 | Length: | 275 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006230384.1 | Gene: | Prss53 / 499270 | RGDID: | 1566127 | Length: | 591 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 66/205 - (32%) |
---|---|---|---|
Similarity: | 93/205 - (45%) | Gaps: | 25/205 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 MRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMV 126
Fly 127 TMNMDVAVVLLNRPM-VGKNIGTLSL--CSTALTPGQTMDVSGW--GMTNPDDEGPGHMLRTVSV 186
Fly 187 PVIEKRICREAYRES----VSISDSMFCASVLGKKDACTYDSGGPLVYEKQ----VCGIVSFGIG 243
Fly 244 CASRRYPGVY 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sems | NP_649270.1 | Tryp_SPc | 43..263 | CDD:214473 | 66/205 (32%) |
Tryp_SPc | 44..265 | CDD:238113 | 66/205 (32%) | ||
Prss53 | XP_006230384.1 | Tryp_SPc | 45..310 | CDD:238113 | |
Tryp_SPc | 341..561 | CDD:238113 | 66/205 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24276 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |