DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG34130

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:253 Identity:71/253 - (28%)
Similarity:115/253 - (45%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PPAYQTRVIGGRVTTNAKLGGYLV--AMRYFN--NFICGGTLIHELIVLTAAHCFED-RAEKEAW 96
            ||.......|.|.|:    ||:.|  .:|..:  .|:||.:.:..|..||:|:|... |::.|:.
  Fly    36 PPVRTLNKNGIRRTS----GGHAVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESL 96

  Fly    97 SVDGGISRLSEKGIRRQ------------VKRFIKSAQFKMVTMNMDVAVVLLNRPMVGKNIGTL 149
            ||:     |.....|:.            ::..|.|..:......|||||:.|...:.|.....:
  Fly    97 SVE-----LVSSDSRQDNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRGNRNNYV 156

  Fly   150 SLCSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAY-----RESVSISDSMF 209
            :||:..|:..:::.|..:|      .||...:||..:.|:.:.||..||     ||:|:      
  Fly   157 TLCTNPLSSYKSLSVVSYG------AGPAENVRTEEIEVLNRMICDSAYGNFLLRETVA------ 209

  Fly   210 CASVLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPFIVKGI 267
            ||....:...|.:.:|.|:....|:||||::...|.....||::||:|.||.||:|.|
  Fly   210 CAKEFKRSADCMFSAGCPVTAGDQLCGIVAWSPACKRSNLPGIFTDIHQVKRFILKAI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 65/241 (27%)
Tryp_SPc 44..265 CDD:238113 67/242 (28%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 60/226 (27%)
Tryp_SPc 53..256 CDD:304450 56/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.