DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG15498

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:239 Identity:44/239 - (18%)
Similarity:73/239 - (30%) Gaps:94/239 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QTRVIGGRVTTNAKLG--------GYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWS 97
            :||.:..|......||        |.:|.:|.....:|...:..:.:||:..             
  Fly    38 RTRAVYDRFYQGTVLGPPQDVLAFGVVVQIRPVKIGVCRQQVSDQNLVLSVV------------- 89

  Fly    98 VDGGISRLSEKGIRRQVKRFIKSAQFKMVTMN--MDVAVVLLNRPMVGKNIGTLSLCSTALTPGQ 160
                   ::::|:.|..|           |:|  .|:.|....||.:..:...:|       |.:
  Fly    90 -------ITQEGLHRNCK-----------TINEMCDLTVAPSPRPALRNSFRIVS-------PNE 129

  Fly   161 ---TMDVSGWG------MTNPDDE------GPGHMLRTVSVPV------------------IEKR 192
               |.....:|      ...|.||      ||..:  .:|:||                  :..:
  Fly   130 DDRTGQYLAYGEKFRLQALEPADEPMYVFSGPKRL--NLSLPVEKAFFTTKNGEVTLPLGLVSHK 192

  Fly   193 ICREAYRESVSISDSMFCASVLGKKDACTYDSGG-------PLV 229
            .|..:.|...| ....|||.   |.....::|.|       |||
  Fly   193 NCGPSARVPTS-HTHFFCAH---KDPDLRFESEGKTIPVHNPLV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 43/237 (18%)
Tryp_SPc 44..265 CDD:238113 42/236 (18%)
CG15498NP_650974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.