DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG10405

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:271 Identity:81/271 - (29%)
Similarity:134/271 - (49%) Gaps:26/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGT 73
            |:||||:   .|:.:.|       :..:|....:|::.||..|..:. .|.:::|.....|||.:
  Fly    12 LIAGILV---ILEASRT-------EAAVPRQPDSRIVNGREATEGQF-PYQLSLRRQTVHICGAS 65

  Fly    74 LIHELIVLTAAHCFE--DRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVV- 135
            ::.....:|||||.:  ::..:|.....|.|.|.| .|..:.||...|...:....||.|||:: 
  Fly    66 ILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRTS-GGTVQPVKAIYKHPAYDRADMNFDVALLR 129

  Fly   136 ----LLNRPMVGKNIGTLSL--CSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRIC 194
                .|:.|: || :..:.|  ...|::......|||||..:..:.....:|::.:|..:.:..|
  Fly   130 TADGALSLPL-GK-VAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKC 192

  Fly   195 REAYRESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYV 259
            ....|....::::||||:. ...|||..|||||:..:..:.||||:|:|||...||||||.:.: 
  Fly   193 HNDLRHHGGVTEAMFCAAA-RNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAH- 255

  Fly   260 KPFIVKGIKAL 270
             |.|.:.|:.|
  Fly   256 -PTIRRWIRLL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 70/228 (31%)
Tryp_SPc 44..265 CDD:238113 70/229 (31%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 71/232 (31%)
Tryp_SPc 37..263 CDD:238113 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.