DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG16749

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:245 Identity:72/245 - (29%)
Similarity:115/245 - (46%) Gaps:36/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVIGGRVTTNAKLGGY--LVAMR-YFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISR 104
            ||:.|   |::.:..|  :::|| ...:..|||::|.:..|:|||||.:.|...:. ||..|:::
  Fly    29 RVVNG---TDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDL-SVQYGVTK 89

  Fly   105 LSEKG---IRRQVKRFIKSAQFKMV-TMNMDVAVVLLNRPMV--GKNIGTLSLCSTALTPGQTMD 163
            ::..|   :|  ||:.|:...:... ....|::::|:..|..  |..:..:.|...|....|| |
  Fly    90 INATGPNVVR--VKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQT-D 151

  Fly   164 VS------GWGMTNPDDEGPGHM---LRTVSVPVIEKRICREAYRESVSISDSMF--CASV-LGK 216
            ..      |||:    :...|::   |:.|.:.|.....|.|.:.   ..:|..:  |..| .|.
  Fly   152 AGGEGVLIGWGL----NATGGYIQSTLQEVELKVYSDEECTERHG---GRTDPRYHICGGVDEGG 209

  Fly   217 KDACTYDSGGPLVYEKQVCGIVSFGI-GCASRRYPGVYTDVHYVKPFIVK 265
            |..|:.||||||:|..|..||||:.| .|....|||||..|.....:|.|
  Fly   210 KGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 70/241 (29%)
Tryp_SPc 44..265 CDD:238113 70/242 (29%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 70/241 (29%)
Tryp_SPc 30..259 CDD:238113 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.