DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG12951

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:259 Identity:73/259 - (28%)
Similarity:120/259 - (46%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NETIDLKKLAKIVLPPAYQ-----TRVIGGRVTTNAKLGGYLVAMR-YFNNFICGGTLIHELIVL 81
            |:.:.|..:..:.:....|     :||:.|..::..|. .::|::| |..:..|||::|.:..|:
  Fly     4 NQDLSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKY-PFVVSLRSYDGSHSCGGSIISKHFVM 67

  Fly    82 TAAHCFEDRAEKEAWSVDGGISRLSEKGIR-RQVKRFIKSAQFKMVTMNM-DVAVVLLNRPMV-- 142
            |||||...| ..:..|:..|::.:|..|.. ..:|:.|:...|.....|. |::::::..|..  
  Fly    68 TAAHCTNGR-PADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFD 131

  Fly   143 GKNIGTLSLCSTALTPGQTMDVS------GWGMTNPDDEGP-GHMLRTVSVPVIEKRICREAYRE 200
            |.::..:.|.:.|....|: |..      |||:.  |..|. ...|:.||:.:.....|...:..
  Fly   132 GVSVAPVELPALAFAVPQS-DAGVEGVLIGWGLN--DTYGSVQDTLQEVSLKIYSDEECTSRHNG 193

  Fly   201 SVSISDSMF--CASV-LGKKDACTYDSGGPLVYEKQVCGIVSFGI-GCASRRYPGVYTDV-HYV 259
            .   :|..:  |..| .|.|..|:.||||||:|..|..||||:.| .|....|||||..| .||
  Fly   194 Q---TDPKYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 70/234 (30%)
Tryp_SPc 44..265 CDD:238113 69/233 (30%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 70/234 (30%)
Tryp_SPc 30..260 CDD:238113 69/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.