DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG10587

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:288 Identity:164/288 - (56%)
Similarity:208/288 - (72%) Gaps:15/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLLFLFLLAGILINNHALQH--NETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMR 63
            |:.||...||...|.:...|..  |:|||:.||||||..|.:||||:||.|||||:|||||:|:|
  Fly     1 MQGLLLYCLLTAPLASIEVLAQDLNQTIDVNKLAKIVQRPGFQTRVVGGDVTTNAQLGGYLIALR 65

  Fly    64 YFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTM 128
            |..||:|||||:|:||||||||||..|.:...|...||.|:|:::||:||||..||||:|:...|
  Fly    66 YEMNFVCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGGASKLNDRGIQRQVKEVIKSAEFREDDM 130

  Fly   129 NMDVAVVLLNRPMVGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRI 193
            |||||::.|.:||.||::|.|.||...|.||..:.|||||:|...:.||..:||||:|||::|:.
  Fly   131 NMDVAILRLKKPMKGKSLGQLILCKKQLMPGTELRVSGWGLTENSEFGPQKLLRTVTVPVVDKKK 195

  Fly   194 CREAYRES-------------VSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCA 245
            ||.:|..:             |.::||||||.|||||||||:||||||||:.|||||||||||||
  Fly   196 CRASYLPTDWESHKHFDLFLKVHLTDSMFCAGVLGKKDACTFDSGGPLVYKNQVCGIVSFGIGCA 260

  Fly   246 SRRYPGVYTDVHYVKPFIVKGIKALLSR 273
            |:||.|||||:.||||||.:.||.||::
  Fly   261 SKRYYGVYTDIMYVKPFIEQSIKVLLAK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 138/232 (59%)
Tryp_SPc 44..265 CDD:238113 139/233 (60%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 138/232 (59%)
Tryp_SPc 46..280 CDD:238113 139/233 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.