DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG10663

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:248 Identity:73/248 - (29%)
Similarity:104/248 - (41%) Gaps:52/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHC---------------FEDRAE 92
            ::||||.....:....:..:..|....||||||....|||||||               :||..|
  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKVLFVRIGEHNLNYEDGTE 570

  Fly    93 KEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMVGKNIGTLSLCSTALT 157
                             |:.:|.:......|...|::.|||::.|.:.:   |..|....|....
  Fly   571 -----------------IQLRVMKSYTHPNFDKRTVDSDVALLRLPKAV---NATTWIGYSCLPQ 615

  Fly   158 PGQTM------DVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCAS-VLG 215
            |.|.:      .:.|||.....|.....:|...:||:|..:.||:.|.: .:|:.:||||. ..|
  Fly   616 PFQALPKNVDCTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYD-YTITKNMFCAGHQKG 679

  Fly   216 KKDACTYDSGGPLV--------YEKQVCGIVSFGIGCASRRYPGVYTDV-HYV 259
            ..|.|..||||||:        :...:.||.|||.|||.|...|:|..| :||
  Fly   680 HIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYV 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 73/248 (29%)
Tryp_SPc 44..265 CDD:238113 73/247 (30%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 73/248 (29%)
Tryp_SPc 507..735 CDD:238113 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.