DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG32374

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:263 Identity:84/263 - (31%)
Similarity:126/263 - (47%) Gaps:20/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTL 74
            |.|.:..|.|:...|..|       .||    ||::.|: ........|..|:.|.|.||||..:
  Fly    51 LPGNISTNPAINALEAQD-------YLP----TRIVNGK-KIKCSRAPYQCALHYNNYFICGCVI 103

  Fly    75 IHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNR 139
            ::...:|||.||  .......::|..|.::....|..|.|::.:....:...||..|:.::.|..
  Fly   104 LNRRWILTAQHC--KIGNPGRYTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKT 166

  Fly   140 PM-VGKNIGTLSLCSTALT--PGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYR-E 200
            |: ||:.:..:.|.||...  | :....||||:|:.:.:.....||.|.|..:.:..|::.|| .
  Fly   167 PLNVGRCVQKVKLPSTRTKRFP-KCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGT 230

  Fly   201 SVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPFIVK 265
            .:.|...|.||. ...:|.|:.|||||||:...:.||.||||||||.:|||||.:|.....:|.|
  Fly   231 GIKIYKQMICAK-RKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIKK 294

  Fly   266 GIK 268
            ..|
  Fly   295 VAK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 72/223 (32%)
Tryp_SPc 44..265 CDD:238113 72/224 (32%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 72/223 (32%)
Tryp_SPc 74..295 CDD:238113 72/225 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.