DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG3650

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:268 Identity:106/268 - (39%)
Similarity:158/268 - (58%) Gaps:20/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLLFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYF 65
            |.|.|||..|..:|:.              ||...:.|    |::||..||.:.:||::|.:||.
  Fly     1 MWRPLFLLQLTQLLLG--------------LASGQIQP----RIVGGTTTTLSAVGGFVVNLRYD 47

  Fly    66 NNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNM 130
            ..|.|||:|:....|:|||||.:. .:....:|.||:|:||:.|:.|:|.|:.....|...::|.
  Fly    48 GTFYCGGSLVTSSHVVTAAHCLKG-YQASRITVQGGVSKLSQSGVVRRVARYFIPNGFSSSSLNW 111

  Fly   131 DVAVVLLNRPMVGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICR 195
            ||.|:.|...:.|..|.|:.||.....||..|.|||||.|...:..|.:.||||.:.:|.|::|:
  Fly   112 DVGVIRLQSALTGSGITTIPLCQVQWNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQ 176

  Fly   196 EAYRESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVK 260
            .||:...:::.|.|||.. |.||:|:.||||.::::.|:|||||:|:|||:.:||||||.||.|:
  Fly   177 RAYQGRDTLTASTFCART-GGKDSCSGDSGGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVR 240

  Fly   261 PFIVKGIK 268
            .||::.||
  Fly   241 SFILRSIK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 92/219 (42%)
Tryp_SPc 44..265 CDD:238113 93/220 (42%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 92/219 (42%)
Tryp_SPc 26..243 CDD:238113 91/218 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.