DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG13430

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:280 Identity:87/280 - (31%)
Similarity:145/280 - (51%) Gaps:22/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLLFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYF 65
            |..|.|...:|..||...|.|::..::            ...|::|| ..|:.....:.|:::..
  Fly     1 MTSLDFRLAVALWLICTSAAQNSTDVE------------QDGRIVGG-WETHITFFPHQVSLQLG 52

  Fly    66 NNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVT-MN 129
            ....||||:|...|:||||||..:.::.:.:.:..|.|..::.|...:||:.|...:|...| ||
  Fly    53 TRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMN 117

  Fly   130 MDVAVVLLNRPMV-GKNIGTLSLCST--ALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEK 191
            .|:|:|.|.:|:| .::|..:||.::  .:.|...:.|||||.|:.....|...||...|.:.::
  Fly   118 NDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQ 182

  Fly   192 RICREAYRESVSISDSMFCASV-LGKKDACTYDSGGPLVY----EKQVCGIVSFGIGCASRRYPG 251
            ..|...|..:.:::::||||.. .|.:|:|..|||||||.    ..::.||||:|.|||:..:||
  Fly   183 NQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPG 247

  Fly   252 VYTDVHYVKPFIVKGIKALL 271
            :||.|.....:|.:.|:.|:
  Fly   248 IYTKVSAYDDWIAQTIEELV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 76/228 (33%)
Tryp_SPc 44..265 CDD:238113 76/229 (33%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 76/228 (33%)
Tryp_SPc 32..262 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.