DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG32269

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:217 Identity:84/217 - (38%)
Similarity:124/217 - (57%) Gaps:5/217 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRL 105
            |:|::||..|| .....|:|.:|..:| :|.|:||.|..|||||||.:..:..: ::|.||.:.|
  Fly   106 QSRIVGGTSTT-ISTTPYIVQLRRGSN-LCSGSLITEQWVLTAAHCVKGYSASD-FTVRGGTTTL 167

  Fly   106 -SEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMVGKNIGTLSLCSTALTPGQTMDVSGWGM 169
             ...|:.|.|.....:.:|....||||.|::.||:.:.|.||||:|:.:.....|..:.::|||:
  Fly   168 DGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTISMGNYRPKAGSRVRIAGWGV 232

  Fly   170 TNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQV 234
            |..........|:|..:.|:.::.||:.||...:|:..|.||...| ||:|:.|||||:.....:
  Fly   233 TKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAG-KDSCSGDSGGPVTRNNTL 296

  Fly   235 CGIVSFGIGCASRRYPGVYTDV 256
            .||||||.|||...||||||.|
  Fly   297 LGIVSFGYGCARAGYPGVYTAV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 83/215 (39%)
Tryp_SPc 44..265 CDD:238113 82/214 (38%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 83/215 (39%)
Tryp_SPc 121..324 CDD:238113 78/201 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455616
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.