DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG9897

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:262 Identity:52/262 - (19%)
Similarity:86/262 - (32%) Gaps:79/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFED--------RAEKEAWSVD 99
            |:|.|. |.|.|...:..::...:...|||.:|.:..:||||.|.:.        |....:....
  Fly    22 RIINGN-TVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCVDGYSARSIQVRLGTSSCGTS 85

  Fly   100 GGISRLSEKGIRRQVK--RFIKSAQFKMVTMNMDVAVVLLNRPMVGKNIGTLSLCSTALTPGQTM 162
            |.|:.:.:..:..|..  ||                         ..|:..|..|....|..:..
  Fly    86 GSIAGICKVKVHSQYSSWRF-------------------------DNNLALLKTCELLNTTDEIK 125

  Fly   163 DVSGWGMTNPDDEGPGHM---------------------------------LRTVSVPVIEKRIC 194
            .:...... |||....::                                 |....|.::.::.|
  Fly   126 PIERADKV-PDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQC 189

  Fly   195 REAYRE-----SVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYT 254
            ...::.     ...|||...|....| |.||:.|.|.|||.:.::.||:| ..||:.:  |.||.
  Fly   190 AADWKVIPFYLLKGISDLTICTKSPG-KGACSTDRGSPLVIDNKLVGILS-RAGCSIK--PDVYA 250

  Fly   255 DV 256
            ::
  Fly   251 NI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 52/262 (20%)
Tryp_SPc 44..265 CDD:238113 51/261 (20%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 52/262 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.