DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG32833

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:222 Identity:49/222 - (22%)
Similarity:91/222 - (40%) Gaps:49/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRL----------SEKGIRRQVKRFIKSAQFK 124
            |.|.:.....::||..|           |||.::::          |:..|...|.......:|.
  Fly    63 CDGAIYKLSHIVTAGKC-----------VDGFLNKVIRVRVGSTTRSDGVIEVAVCNITVHEKFT 116

  Fly   125 MVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWGMTNP-------------DDE 175
            ..|:..:||::.|..|: ..|.|..:.|.:...:.|..:..:||    |             |||
  Fly   117 GQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGW----PSFRWWAMYWKKCLDDE 177

  Fly   176 GPGHMLRTVSVPVIEKRICREAYRES----VSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCG 236
              .:.|:...|.::....|.:.:..:    .:.:|.:||..... |:||:...|.|:|:..::.|
  Fly   178 --AYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEKFA-KEACSLAMGSPVVHNGKLVG 239

  Fly   237 IVSFGIGCASRRYPGVYTDVHYVKPFI 263
            |::.| ||:  .||.||.::...|.::
  Fly   240 IITKG-GCS--EYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 49/220 (22%)
Tryp_SPc 44..265 CDD:238113 49/222 (22%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 49/222 (22%)
Tryp_SPc 40..262 CDD:214473 49/219 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.