DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG11192

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:241 Identity:81/241 - (33%)
Similarity:127/241 - (52%) Gaps:16/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSE 107
            |::||.|.|..:. .|.|:::.....||||.:|....||||||||||......::|..|.|....
  Fly    27 RIVGGEVATIQEF-PYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEHES 90

  Fly   108 KGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTALTP--GQTMDVSGWGM 169
            .|....::|.|....:...:.:.|:|:::||..: ..:::..:.|.:.|..|  ...:.|||||.
  Fly    91 GGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGF 155

  Fly   170 TNPD-----DEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGKKDACTYDSGGPLV 229
            ...:     :.|....||.|.|.::|...||.||.:.:.|:..|.||:..| :|:|..|||||||
  Fly   156 QAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAARPG-RDSCQGDSGGPLV 219

  Fly   230 -YEKQ-----VCGIVSFGIGCASRRYPGVYTDVHYVKPFIVKGIKA 269
             |..:     :.||||:|:|||:..:|||||:|...:.:|.:.:.|
  Fly   220 GYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLDA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 79/233 (34%)
Tryp_SPc 44..265 CDD:238113 79/234 (34%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 79/233 (34%)
Tryp_SPc 28..262 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.