DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG8299

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:267 Identity:89/267 - (33%)
Similarity:128/267 - (47%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLLFLFLLA--GILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMR 63
            |...|.|||||  |::|            |...|.|      .|.::||.....|.. .|.|::|
  Fly     1 MSLRLGLFLLAALGVVI------------LTDSASI------STHIVGGDQADIADF-PYQVSVR 46

  Fly    64 ---YFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDG--GISRLSEKGIRRQVKRFIKSAQF 123
               |....||||::....:|:|||||.:.|.......|.|  .|:.|.|:|::  |.:.|..|.:
  Fly    47 LETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIADLEEQGVK--VSKLIPHAGY 109

  Fly   124 KMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVP 187
            ...|...|:.:::...|: ....:..:::...|...|....|||||....|||....|||.|.:.
  Fly   110 NKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQ 174

  Fly   188 VIEKRICREAY-RESVSISDSMFCASVL-GKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYP 250
            :|||..|...| .:..:::|.|.||..| |.||.|..||||||..:..:.|:||:|:||....:|
  Fly   175 IIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFP 239

  Fly   251 GVYTDVH 257
            ||||.|:
  Fly   240 GVYTSVN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 76/223 (34%)
Tryp_SPc 44..265 CDD:238113 76/222 (34%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 76/223 (34%)
Tryp_SPc 28..255 CDD:238113 76/222 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.