DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and iotaTry

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:234 Identity:76/234 - (32%)
Similarity:120/234 - (51%) Gaps:14/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVIGG--RVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRL 105
            |:|||  ::..||.   :.|:::......|||.:..:.|::||.||..:|: .....|..|....
  Fly    27 RIIGGSDQLIRNAP---WQVSIQISARHECGGVIYSKEIIITAGHCLHERS-VTLMKVRVGAQNH 87

  Fly   106 SEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMV-GKNIGTLSLCSTALTPGQTMDVSGWGM 169
            :..|....|..:....||....::.|:||:.|:.|:. |.:...::|.||:.:.|.|:.|:|||.
  Fly    88 NYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTVTGWGH 152

  Fly   170 TNPDDEGPGHMLRTVSVPVIEKRIC---REAYRESVSISDSMFCASVLGKKDACTYDSGGPLVYE 231
            |  |:......|:...:.:|::..|   :..|.... :.:...||:.. ..||||.|||||||..
  Fly   153 T--DNGALSDSLQKAQLQIIDRGECASQKFGYGADF-VGEETICAAST-DADACTGDSGGPLVAS 213

  Fly   232 KQVCGIVSFGIGCASRRYPGVYTDVHYVKPFIVKGIKAL 270
            .|:.||||:|..||...|||||.||..::|:|||...|:
  Fly   214 SQLVGIVSWGYRCADDNYPGVYADVAILRPWIVKAANAI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 72/225 (32%)
Tryp_SPc 44..265 CDD:238113 72/226 (32%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 72/225 (32%)
Tryp_SPc 28..247 CDD:238113 72/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.