DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and Send2

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:277 Identity:73/277 - (26%)
Similarity:128/277 - (46%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFIC 70
            ||.|||              ::......::.|   :.|:|||: ....:...:.|:::.....:|
  Fly     6 FLLLLA--------------LNSLSAGPVIRP---EERIIGGQ-PIGIEEAPWQVSIQRDGKHLC 52

  Fly    71 GGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVV 135
            ||::....|::|||||    .:.:.:.|..|.:..:..|....|.. |::.:    .:..|:|:|
  Fly    53 GGSIYSADIIITAAHC----VQGQGYQVRAGSALKNSNGSVVDVAA-IRTHE----GLGNDIAIV 108

  Fly   136 LLNRPMVGKN-IGTLSLCSTALTPGQTMDVSGWG----MTNPDDEGPGHMLRTVSVPVIEKRICR 195
            .|::|:...| :..:.|..|...||....|||||    .::|.|      |:.|::.:.....| 
  Fly   109 RLSKPLEFTNQVQPIPLAKTNPPPGSIAFVSGWGSSSYYSHPID------LQGVNLYIQWPYYC- 166

  Fly   196 EAYRESVSISD-SMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGI-GCASRRYPGVYTDVHY 258
                   .::: |..||...|:. ||..|||||||:::|:.|:||.|. .|.   |..:||.|.|
  Fly   167 -------GLTEPSRICAGSFGRA-ACKGDSGGPLVFDQQLVGVVSGGTKDCT---YSSIYTSVPY 220

  Fly   259 VKPFIVKGIKALLSRSR 275
            .:.:|:..|..::|.:|
  Fly   221 FREWILNAIDEIMSANR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 63/226 (28%)
Tryp_SPc 44..265 CDD:238113 63/227 (28%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 63/226 (28%)
Tryp_SPc 27..225 CDD:238113 62/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.