DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and Phae2

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:223 Identity:57/223 - (25%)
Similarity:100/223 - (44%) Gaps:10/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGG---ISR 104
            ||:||:... |....|:|:|:|.....|...:|:...::|||||..:|.:....::..|   ::.
  Fly    31 RVVGGKAAA-ANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAG 94

  Fly   105 LSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMV-GKNIGTLSLCSTALTPGQTMDVSGWG 168
            .:....:||:..::.:..:...|:..|:.::....... ...:..:.|.|:.:.|....|:.|||
  Fly    95 TASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWG 159

  Fly   169 MTNPDDEG--PGHMLRTVSVPVIEKRICREAY-RESVSISDSMFCASVL-GKKDACTYDSGGPLV 229
            .|:..:..  |..:....::|:|....|..|. .:...:..:..|...| |....||.|||||||
  Fly   160 STSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLV 224

  Fly   230 YEKQVCGIVSFG-IGCASRRYPGVYTDV 256
            ....:.||||:| :.|.....|.||..|
  Fly   225 QGNVLIGIVSWGKLPCGQPNSPSVYVQV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 57/223 (26%)
Tryp_SPc 44..265 CDD:238113 56/222 (25%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 57/223 (26%)
Tryp_SPc 32..262 CDD:238113 56/222 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.