DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and PRSS53

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:161 Identity:52/161 - (32%)
Similarity:74/161 - (45%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAV 134
            |||.|:.|..||||||||..|...|.|||..| :|..|.|:    |:.|....:.......|:|:
Human   373 CGGALVSEEAVLTAAHCFIGRQAPEEWSVGLG-TRPEEWGL----KQLILHGAYTHPEGGYDMAL 432

  Fly   135 VLLNRPM-VGKNIGTLSL--CSTALTPGQTMDVSGW--GMTNPDDEGPG-HMLRTVSVPVIEKRI 193
            :||.:|: :|.::..|.|  ....|..|:    .||  |...|   |.| ..|:||.|.::..|.
Human   433 LLLAQPVTLGASLRPLCLPYPDHHLPDGE----RGWVLGRARP---GAGISSLQTVPVTLLGPRA 490

  Fly   194 CREAYR----ESVSISDSMFCASVLGKKDAC 220
            |...:.    :...|...|.|.|.:|:..:|
Human   491 CSRLHAAPGGDGSPILPGMVCTSAVGELPSC 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 52/161 (32%)
Tryp_SPc 44..265 CDD:238113 52/161 (32%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113
Tryp_SPc 43..314 CDD:214473
Tryp_SPc 359..>512 CDD:304450 48/150 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.