DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG4271

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:192 Identity:52/192 - (27%)
Similarity:87/192 - (45%) Gaps:7/192 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAV 134
            |||.:|...||||||.|.:::..|.. :|..|...:...|...:|...:....:|  ..:.|:|:
  Fly    44 CGGAVIDSRIVLTAAQCVKNKPVKRI-TVRVGTPDIYRGGRIIRVTALVVHENYK--NWDNDIAL 105

  Fly   135 VLLNRPMVGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYR 199
            :.|.:|::...:..:.|.:...:..:....:|||....:.......|:.....:..:.:|.|...
  Fly   106 LWLEKPVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELV 170

  Fly   200 ESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDV-HYVK 260
            |.|  .:.:.|| ...:.|.|..|.|||||...:|.||...|.||.....|.:||:| ||::
  Fly   171 EPV--GEELLCA-FYTENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFHYLE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 52/192 (27%)
Tryp_SPc 44..265 CDD:238113 52/192 (27%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 52/192 (27%)
Tryp_SPc 19..231 CDD:214473 52/192 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.