DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG1304

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:241 Identity:67/241 - (27%)
Similarity:106/241 - (43%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEK-------- 93
            |.:...||:||......:. .:.|::|...:..|||:::....|||||||..::...        
  Fly    25 PGSLNGRVVGGEDAVKNQF-PHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAA 88

  Fly    94 EAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMV-GKNIGTLSLCSTALT 157
            |.:::..|.:.....|:..||...|...::... :| |||::.|..|:: ..:|..:.| .||.|
  Fly    89 ERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNF-LN-DVALLRLESPLILSASIQPIDL-PTADT 150

  Fly   158 PGQT-MDVSGWGMTNPDDEGPGHM----LRTVSVPVIEKRICREAYRESVSISDSMFCASVLGKK 217
            |... :.:||||......:.|.::    |:::|   :|:  |.|.....|   .|..|.......
  Fly   151 PADVDVIISGWGRIKHQGDLPRYLQYNTLKSIS---LER--CDELIGWGV---QSELCLIHEADN 207

  Fly   218 DACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPFI 263
            .||..|||||.||..||.|:..|........||..|..|:|...:|
  Fly   208 GACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 65/233 (28%)
Tryp_SPc 44..265 CDD:238113 65/234 (28%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 65/233 (28%)
Tryp_SPc 32..256 CDD:238113 65/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.