DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and Prss53

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:211 Identity:63/211 - (29%)
Similarity:91/211 - (43%) Gaps:37/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMV 126
            :::.....|||.|:.|::||||||||..|...|.|||..|... .|.|:    |:.|....:...
Mouse   318 LKHHGKLACGGALVSEVVVLTAAHCFIGRQTLEEWSVGLGAGP-EEWGL----KQLILHGAYTHP 377

  Fly   127 TMNMDVAVVLLNRPM-VGKNIGTLSL--CSTALTPGQTMDVSGW--------GMTNPDDEGPGHM 180
            ....|||.:||.:|: :|..:..|.|  ....|..|:    .||        |:..|        
Mouse   378 EGGYDVAFLLLAQPVTLGPGLRPLCLPYADHHLPDGE----HGWVLGLTQKAGINYP-------- 430

  Fly   181 LRTVSVPVIEKRICREAYR----ESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQ----VCGI 237
             :||.|.|:....|...:.    ..:.|...|.|.:|:|:...|...||.|||:|.:    :.|:
Mouse   431 -QTVPVTVLGPMACSRQHAAPGGTGIPILPGMVCTTVVGEPPHCEGLSGAPLVHEIRGTWFLVGL 494

  Fly   238 VSFGIGCASRRYPGVY 253
            .|||..|.|...|.|:
Mouse   495 HSFGDTCQSSAKPAVF 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 63/211 (30%)
Tryp_SPc 44..265 CDD:238113 63/211 (30%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113
Tryp_SPc 311..522 CDD:238113 63/211 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.