DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and LOC3291694

DIOPT Version :10

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_555167.2 Gene:LOC3291694 / 3291694 VectorBaseID:AGAMI1_013239 Length:277 Species:Anopheles gambiae


Alignment Length:51 Identity:13/51 - (25%)
Similarity:20/51 - (39%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FECFESEKSSIEAPYIACLSQRVFPEYGSPRRQTSLLLIEDEQDDNDTPYD 92
            |...|...:...:||.....||:  |...|  ...::..|.|.:|...||:
Mosquito   629 FGFMEGSGAGTPSPYREPPLQRL--EKNRP--PAEVIEEETENEDESEPYE 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 12/50 (24%)
LOC3291694XP_555167.2 None

Return to query results.
Submit another query.