DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG9676

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:274 Identity:75/274 - (27%)
Similarity:120/274 - (43%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGY--LVAMRYFNN 67
            |.:...||:|..|.:               |:.|    |::||   |.|:.|.:  .:::|...:
  Fly     8 LLVLCAAGVLAQNDS---------------VVEP----RIVGG---TKAREGQFPHQISLRRRGS 50

  Fly    68 FICGGTLIHELIVLTAAHCFE---DRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMN 129
            ..|||::|.:..|:|||||.:   :.|......:..|...||..|:|..|........:.  :..
  Fly    51 HTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNG 113

  Fly   130 MDVAVVLLNRPMV-GKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEGP-GHMLRTVSVPVIEKR 192
            .||||:.|...:. ..||..:.|.:.......|:|:||||..:  ..|| .:.|..|.|..:.:.
  Fly   114 HDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDISGWGAIS--QRGPISNSLLYVQVKALSRE 176

  Fly   193 ICREAYRESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVH 257
            .|::.|..  .:.::..|......|.||..|||||..|:.::.|:.||.||...|..|..|..|.
  Fly   177 SCQKTYLR--QLPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVS 239

  Fly   258 YVKPFIVKGIKALL 271
            .::.:|.:  ||.|
  Fly   240 KLRNWIAE--KASL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 64/226 (28%)
Tryp_SPc 44..265 CDD:238113 64/227 (28%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 64/226 (28%)
Tryp_SPc 28..248 CDD:238113 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.