DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG31267

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:237 Identity:58/237 - (24%)
Similarity:109/237 - (45%) Gaps:17/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YQTRVIGGRVTTNAKLGGYLVAMR--YFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGI 102
            :.:|::||. .::.....|||:::  |.|:| |.|::||:..|:|||.|.....:.....|....
  Fly    41 FSSRIVGGE-ESDVLAAPYLVSLQNAYGNHF-CAGSIIHDQWVITAASCLAGLRKNNVQVVTTTY 103

  Fly   103 SRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVV----LLNRPMVGKNIGTLSLCSTALTPGQTMD 163
            :....:|....|:..:....|.....:.|:|::    |.:...|.:||....|  ..||.|:|:.
  Fly   104 NHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPL--EDLTDGETLT 166

  Fly   164 VSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGK--KDACTYDSGG 226
            :.|:|.|....:. ...|:.:.|..:....|...|..:..:.....||  :||  ..||..|:||
  Fly   167 MYGYGSTEIGGDF-SWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCA--VGKVGAGACHGDTGG 228

  Fly   227 PLVYEK-QVCGIVSFGIGCASRRYPGVYTDVHYVKPFIVKGI 267
            |:|..: ::.|:.::|:.| ...:|.|:..:.:...:|:..|
  Fly   229 PIVDSRGRLVGVGNWGVPC-GYGFPDVFARISFYYSWIISTI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 56/228 (25%)
Tryp_SPc 44..265 CDD:238113 56/229 (24%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 56/228 (25%)
Tryp_SPc 45..268 CDD:238113 56/230 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.