DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and CG32834

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:288 Identity:73/288 - (25%)
Similarity:109/288 - (37%) Gaps:65/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFI 69
            :||||||.:|.....       ||..          |:|:||| ...:.:...|...:......|
  Fly     5 VFLFLLAALLRPVRG-------DLDA----------QSRIIGG-YDVDIEDAPYQAEVIIDGTAI 51

  Fly    70 CGGTLIHELIVLTAAHC------FEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTM 128
            |.|.:|....::|||.|      .|.|....:...||       .|...:|...|...|:.....
  Fly    52 CSGAIITSDTIITAASCVQSYGSIEVRVGTSSRDYDG-------TGFLLEVCEIINHPQYNCWRF 109

  Fly   129 NMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWGMTN-------------PDDEGPGH 179
            :.::|::.|..|: ..:.|..:|:.......|....|||||.|:             ||      
  Fly   110 DNNLALLKLCDPLKTSEAIQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPD------ 168

  Fly   180 MLRTVSVPVIEKRICREAYRESV-------SISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGI 237
            .|:...|.|..:..|  |....|       .||....|..  .....|:||:|.|||.:.|:.||
  Fly   169 YLQMAWVSVYNREQC--AADRGVWFGLWDNGISYLTLCTH--NGAGGCSYDTGAPLVIDGQLVGI 229

  Fly   238 VSFGIGCASRRYPGVYTDVHYVKPFIVK 265
            :|.| ||.::  |.||.:|.:...:|.:
  Fly   230 LSEG-GCTTK--PDVYANVPWFTGWIAE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 62/246 (25%)
Tryp_SPc 44..265 CDD:238113 62/247 (25%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 62/246 (25%)
Tryp_SPc 27..255 CDD:238113 62/249 (25%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.