DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and Try4

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:276 Identity:85/276 - (30%)
Similarity:133/276 - (48%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRLLFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYF 65
            |:.||||.|:.                    |.:..|.....:::|| .|.......|.|::...
Mouse     1 MRALLFLALVG--------------------AAVAFPVDDDDKIVGG-YTCRENSVPYQVSLNSG 44

  Fly    66 NNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIR--RQVKRFIKSAQ------ 122
            .:| |||:||::..|::||||::.|.:          .||.|..|.  ...::|:.||:      
Mouse    45 YHF-CGGSLINDQWVVSAAHCYKSRIQ----------VRLGEHNINVLEGNEQFVNSAKIIKHPN 98

  Fly   123 FKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTALTPGQTMDVSGWGMT------NPDDEGPGHM 180
            |...|:|.|:.::.|..|: :...:.|::|.|:....|....:||||.|      |||      :
Mouse    99 FNSRTLNNDIMLIKLASPVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPD------L 157

  Fly   181 LRTVSVPVIEKRICREAYRESVSISDSMFCASVL-GKKDACTYDSGGPLVYEKQVCGIVSFGIGC 244
            |:.:..|::.:..|..:|  ...|:::|.|...| |.||:|..|||||:|...|:.||||:|.||
Mouse   158 LQCLDAPLLPQADCEASY--PGKITNNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGC 220

  Fly   245 ASRRYPGVYTDV-HYV 259
            |.:..|||||.| :||
Mouse   221 ALKDNPGVYTKVCNYV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 77/234 (33%)
Tryp_SPc 44..265 CDD:238113 77/233 (33%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 77/234 (33%)
Tryp_SPc 24..242 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.