DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and Klkb1

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:279 Identity:91/279 - (32%)
Similarity:139/279 - (49%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KLAKIVLPPAYQT----RVIGGRVTTNAKLGGY---------LVAMRYFNNFICGGTLIHELIVL 81
            :|.|:|..|...|    |::||   |||.||.:         ||:..:    :|||::|....||
Mouse   373 RLCKLVDSPDCTTKINARIVGG---TNASLGEWPWQVSLQVKLVSQTH----LCGGSIIGRQWVL 430

  Fly    82 TAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQ-----VKRFIKSAQFKMVTMNMDVAVVLLNRPM 141
            ||||||:.....:.|.:.|||..|||  |.::     :|..|...::|:...|.|:|::.|..|:
Mouse   431 TAAHCFDGIPYPDVWRIYGGILSLSE--ITKETPSSRIKELIIHQEYKVSEGNYDIALIKLQTPL 493

  Fly   142 VGKNIGTLS--LCSTALTPGQTMD----VSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRE 200
               |.....  :|..:.....|:.    |:|||.|....| ..::|:..::|::....|::.||:
Mouse   494 ---NYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKEQGE-TQNILQKATIPLVPNEECQKKYRD 554

  Fly   201 SVSISDSMFCASVL-GKKDACTYDSGGPLVYEK----QVCGIVSFGIGCASRRYPGVYTDVHYVK 260
            .| |:..|.||... |..|||..|||||||.:.    |:.||.|:|.|||.:..|||||.|....
Mouse   555 YV-INKQMICAGYKEGGTDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKDQPGVYTKVSEYM 618

  Fly   261 PFIVK-----GIKALLSRS 274
            .:|::     .::||.:.|
Mouse   619 DWILEKTQSSDVRALETSS 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 82/244 (34%)
Tryp_SPc 44..265 CDD:238113 82/245 (33%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519 0/1 (0%)
Tryp_SPc 390..621 CDD:214473 82/244 (34%)
Tryp_SPc 391..621 CDD:238113 81/243 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.