DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fng and YHR210C

DIOPT Version :9

Sequence 1:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_012080.3 Gene:YHR210C / 856617 SGDID:S000001253 Length:341 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:21/94 - (22%)
Similarity:37/94 - (39%) Gaps:27/94 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 AASPTTVIIRKDIRSFNFSDIEVSERPTATLLTELARRSRNGELLRD---LSQRAVTATPQPPVT 145
            |..||..|:::.|.:|:      |.:||               :|:|   :...|........:.
Yeast   208 ALIPTGKIVQRKIATFD------SSKPT---------------ILQDDGPIYDYAFIVDENKNLK 251

  Fly   146 ELDDIFIS--VKTTKNYHD-TRLALIIKT 171
            ..|.:.::  |...|.||. :||:|.:.|
Yeast   252 TTDSVSVNKLVPAFKAYHPASRLSLEVST 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fngNP_524191.1 Fringe 145..394 CDD:190308 9/30 (30%)
YHR210CNP_012080.3 galactose_mutarotase_like 13..339 CDD:185696 21/94 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.