DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fng and AT1G07850

DIOPT Version :9

Sequence 1:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_172263.4 Gene:AT1G07850 / 837300 AraportID:AT1G07850 Length:541 Species:Arabidopsis thaliana


Alignment Length:265 Identity:68/265 - (25%)
Similarity:102/265 - (38%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DLSQRAVTATPQPP---VTELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDDHYY 191
            |:..|.....||.|   .|.||.|...:..:....:||.. .||:|::..:.:...:.|.....|
plant   105 DVPPRVPALYPQRPRMFNTTLDHIVFGIAASSVLWETRKE-YIKSWWRPGKTRGVVWIDKRVRTY 168

  Fly   192 QEKTKGHLINTKCSQ--GHFR------KALCCKMSAELDVFLESGKK---WFCHFDDDNYVNVPR 245
            :...   |...:.||  ..||      .....::|..:...|..|||   ||...|||....|..
plant   169 RNDP---LPEIRISQDTSRFRYTHPVGDRSAVRISRVVTETLRLGKKGVRWFVMGDDDTVFVVDN 230

  Fly   246 LVKLLDEYSPSVDWYLGKPSISSPLEIHLDSKNTTTNKKITFWFATGGAGFCLSRALTLKMLPIA 310
            :|.:|.:|..:..:|:|..|     |.|:.      |...::..|.||.||.:|.||.|::|   
plant   231 VVNVLSKYDHTQFYYVGSSS-----EAHVQ------NIFFSYSMAFGGGGFAISYALALELL--- 281

  Fly   311 GGGKFISIGDKI--RFP-----DDVTMGFIIEHLLKVPLTVVDNFHSHLEPMEFIRQDTFQDQVS 368
                  .:.|:.  |:|     ||.....:.|  |.||||....||.:         |.:.|.:.
plant   282 ------RMQDRCIQRYPGLYGSDDRIQACMTE--LGVPLTKEPGFHQY---------DVYGDLLG 329

  Fly   369 FSYAH 373
            ...||
plant   330 LLGAH 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fngNP_524191.1 Fringe 145..394 CDD:190308 63/247 (26%)
AT1G07850NP_172263.4 DUF604 255..509 CDD:282497 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.