DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fng and AT4G00295

DIOPT Version :9

Sequence 1:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_567166.2 Gene:AT4G00295 / 828072 AraportID:AT4G00295 Length:467 Species:Arabidopsis thaliana


Alignment Length:384 Identity:79/384 - (20%)
Similarity:133/384 - (34%) Gaps:111/384 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DQLLQDYVQSSTPTQPGAGAPAASPTTVI----IRKDIRSFNF----SDIEVSERPTATLLTELA 119
            ||....|.:|:.|....:.:|.:....|:    :...:.||:|    :....|:.|.:.|:..: 
plant     3 DQKTLSYDKSNKPFYSSSSSPCSFTAIVVFLIFVSYLLYSFSFISFLNPYSPSKSPNSLLVPVI- 66

  Fly   120 RRSRNGELLRDLSQRAVTATPQPPVTELDDIFISVKTTKNYHDTRLALIIKTWFQ---------- 174
             |..:|:            ||:.. |||..|...:..:.:....|.. .:|||::          
plant    67 -RLGSGQ------------TPEEQ-TELKHIVFGIAASSDLWKHRRE-YVKTWWKPNGVMNGAVW 116

  Fly   175 ------------LARDQTWFFTDTDDHYYQEKTKGHLINTKCSQGHFRKALCCKMSAELDVFL-- 225
                        .|..|....:||....|:.:           .||.......::.:|....|  
plant   117 LDKPINDTVSSSSALPQIRISSDTSSFKYRYR-----------NGHRSAIRITRIVSETVRMLNG 170

  Fly   226 ---ESGKKWFCHFDDDNYVNVPRLVKLLDEYSPSVDWYLGKPSISSPLEIHLDSKNTTTNKKITF 287
               |...:|....|||.......||::|.:|.....:|:|.||     |.||.:.:     :.::
plant   171 TEAERNVRWVVMGDDDTVFFTENLVRVLRKYDHKQFYYIGAPS-----ESHLQNLH-----QFSY 225

  Fly   288 WFATGGAGFCLSRALTLKMLPIAGGGKFISIGDKI--RF-----PDDVTMGFIIEHLLKVPLTVV 345
            ..|.||.||.:|..|. |:|.        .:.|:.  |:     .||.....:.|  |.||||..
plant   226 GMAYGGGGFAISYPLA-KVLE--------KMQDRCIERYSDLYGSDDRIHACMAE--LGVPLTKE 279

  Fly   346 DNFHSHLEPMEFIRQDTFQDQVSFSYAHMKNQWNVIKVDGFDMKTDPKRFYSLHCQLFP 404
            ..||..         |.:.:.:.....|  .|..::.:...|: .||         :||
plant   280 VGFHQF---------DVYGNLLGLLSVH--PQAPIVSIHHLDV-VDP---------IFP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fngNP_524191.1 Fringe 145..394 CDD:190308 60/282 (21%)
AT4G00295NP_567166.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.