DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fng and AT4G15240

DIOPT Version :9

Sequence 1:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_193259.2 Gene:AT4G15240 / 827190 AraportID:AT4G15240 Length:488 Species:Arabidopsis thaliana


Alignment Length:194 Identity:41/194 - (21%)
Similarity:74/194 - (38%) Gaps:36/194 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RRSRNGELLRDLSQRAVTATPQPPVTELDDIFISVKTTKNYHDT--RLALIIKTWFQLARDQTWF 182
            ||.:...:.|.||..:         |....:..|:..:   ||:  |.:..::.|:.....:...
plant    62 RREQISSIARSLSVFS---------TRRRHLLFSIAAS---HDSWLRRSSYVRLWYSPESTRAVV 114

  Fly   183 FTDTDDHYYQEKTKGHLINTKCSQ------GHFRKALCCKMSAELDVFLESGKK---WFCHFDDD 238
            |.|.............:::...|:      |..|.|:  :::..:...::.|.|   ||...|||
plant   115 FLDRGGLESDLTLPPVIVSKDVSRFPYNFPGGLRSAI--RVARVVKETVDRGDKDVRWFVFGDDD 177

  Fly   239 NYVNVPRLVKLLDEYSPSVDWYLGKPSISSPLEIHLDSKNTTTNKKITFWFATGGAGFCLSRAL 302
            ....|..||.:|.:|.....:|:|.           :|:....|.:.:|..|.||.||.:|.:|
plant   178 TVFFVDNLVTVLSKYDHRKWFYVGS-----------NSEFYDQNVRYSFDMAFGGGGFAISASL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fngNP_524191.1 Fringe 145..394 CDD:190308 36/169 (21%)
AT4G15240NP_193259.2 DUF604 209..461 CDD:398362 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10811
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.