DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fng and AT4G11350

DIOPT Version :9

Sequence 1:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_192874.2 Gene:AT4G11350 / 826737 AraportID:AT4G11350 Length:507 Species:Arabidopsis thaliana


Alignment Length:257 Identity:62/257 - (24%)
Similarity:95/257 - (36%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 QRAVTAT-----PQPPVTELDDIFISV-------KTTKNYHDTRLALIIKTWF--QLARDQTW-- 181
            ::|||.|     .:...|:|:.:...:       |..|.|        ||.|:  :..|...|  
plant    70 KKAVTVTVKAVPAEQEATDLNHVVFGIAASSKLWKQRKEY--------IKIWYKPKKMRGYVWLD 126

  Fly   182 ----FFTDTDDHYYQEKTKGHLINTKCS-------QGHFRKALCCKMSAELDVFLESGKK----W 231
                ..::|.|   ||......|:...|       |||.......::.:|..:.|:|..|    |
plant   127 EEVKIKSETGD---QESLPSVRISGDTSSFPYTNKQGHRSAIRISRIVSETLMSLDSESKKNVRW 188

  Fly   232 FCHFDDDNYVNVPRLVKLLDEYSPSVDWYLGKPSISSPLEIHLDSKNTTTNKKITFWFATGGAGF 296
            |...|||.......|:::|.:|.....:|:|..|     |.||.      |...::..|.||.||
plant   189 FVMGDDDTVFVTDNLIRVLRKYDHEQMYYIGSLS-----ESHLQ------NIIFSYGMAYGGGGF 242

  Fly   297 CLSRALTLKMLPIAGGGKFISIGDKI--RFP-----DDVTMGFIIEHLLKVPLTVVDNFHSH 351
            .:|..|.:.:         ..:.|:.  |:|     ||.....:.|  |.||||....||.:
plant   243 AISYPLAVAL---------SKMQDQCIQRYPALYGSDDRMQACMAE--LGVPLTKEIGFHQY 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fngNP_524191.1 Fringe 145..394 CDD:190308 58/240 (24%)
AT4G11350NP_192874.2 Galactosyl_T 87..292 CDD:389837 57/237 (24%)
DUF604 227..480 CDD:368036 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.