DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fng and lfng

DIOPT Version :9

Sequence 1:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001017051.1 Gene:lfng / 549805 XenbaseID:XB-GENE-487975 Length:372 Species:Xenopus tropicalis


Alignment Length:357 Identity:155/357 - (43%)
Similarity:215/357 - (60%) Gaps:25/357 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DQLLQDYVQSSTPTQPGAGAPAASPTTVIIRKDIRSFNFSDIEVSERPTATLLTELARRSRNGEL 127
            ||..:..|||.  .:|||||       ..:|..:...|..|...:.:......|..|..::...:
 Frog    27 DQQSRPMVQSR--EEPGAGA-------AHLRAALEPANPGDEGNANKGAQDAGTFSAYFNKLTRV 82

  Fly   128 LRDLSQRAVTATP----QPPVTEL--DDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDT 186
            .||:.|   .|||    |.||.::  :|:||:|||||.:|.:|:.|::.||....:.||:.|||.
 Frog    83 RRDVEQ---VATPSKASQAPVEDITANDVFIAVKTTKKFHRSRMDLLMDTWISRNKAQTFIFTDG 144

  Fly   187 DDHYYQEKTKGHLINTKCSQGHFRKALCCKMSAELDVFLESGKKWFCHFDDDNYVNVPRLVKLLD 251
            :|...|:|| |::|:|.||..|.|:||.|||:.|.|.|:||.||||||.||||||||..|||||.
 Frog   145 EDEELQKKT-GNVISTNCSAAHSRQALSCKMAVEYDKFIESNKKWFCHVDDDNYVNVQTLVKLLS 208

  Fly   252 EYSPSVDWYLGKPSISSPLEIHLDSKNTTTN--KKITFWFATGGAGFCLSRALTLKMLPIAGGGK 314
            .||.:.|.|:||||:..|::.   ::..:.|  :.:.|||||||||||:||.|.|||.|.|.||.
 Frog   209 RYSHTNDIYIGKPSLDRPIQA---TERISENNMRPVNFWFATGGAGFCISRGLALKMSPWASGGN 270

  Fly   315 FISIGDKIRFPDDVTMGFIIEHLLKVPLTVVDNFHSHLEPMEFIRQDTFQDQVSFSYAHMKNQWN 379
            |::..:|||.|||.|:|:|||.:|.|.|...:.||||||.:..:.|....:||:.||...:|:.|
 Frog   271 FMNTAEKIRLPDDCTIGYIIESVLGVKLIRSNLFHSHLENLHQVPQSEIHNQVTLSYGMFENKRN 335

  Fly   380 VIKVDG-FDMKTDPKRFYSLHCQLFPYFSFCP 410
            .|.:.| |.::.||.||.|:||.|:|...:||
 Frog   336 AILMKGAFSVEEDPSRFRSVHCLLYPDTPWCP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fngNP_524191.1 Fringe 145..394 CDD:190308 122/253 (48%)
lfngNP_001017051.1 Fringe 103..351 CDD:367085 122/251 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 255 1.000 Domainoid score I2007
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I2930
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D356445at33208
OrthoFinder 1 1.000 - - FOG0002392
OrthoInspector 1 1.000 - - otm49118
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4573
SonicParanoid 1 1.000 - - X1586
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.