DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fng and Y19D10A.16

DIOPT Version :9

Sequence 1:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001041189.1 Gene:Y19D10A.16 / 4363084 WormBaseID:WBGene00044734 Length:330 Species:Caenorhabditis elegans


Alignment Length:204 Identity:41/204 - (20%)
Similarity:66/204 - (32%) Gaps:59/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 HSQVDALASEA------VTTHRDQLLQDYVQSSTPTQPGAGAPA--------ASPTTVIIRKDIR 97
            :.|.|.|..:|      ....|:||:.::  .:|...||..|..        .|.|......::.
 Worm   120 NEQDDGLPGDAKIDVTYTVNDRNQLIIEH--HATCDTPGLLALTNHAYWNLDGSDTVAEHFLEME 182

  Fly    98 SFNFSDIEVSERPTATLLT------------ELARRSRNGELLRDLSQRAVTATPQPPVT----- 145
            :..|.:::.:..||..:.:            :|....::.|.|.||....|.....||.|     
 Worm   183 ADEFVEVDDTFCPTGAIRSVTDTGFDFRSGKQLKESGKDAEELLDLDNDLVITKKTPPSTPSTYL 247

  Fly   146 ----ELDDIFISVKTT------------------KNYHDTRLALIIKTWFQLARDQTWFFTDTD- 187
                |...|.:|:.|:                  ..::....||.|:..|..|......|.|.. 
 Worm   248 RFWSEKSGIELSITTSYPVIHLYASKFLDCKGKKGEHYKANKALAIEPQFHSAAPNFDHFPDVSL 312

  Fly   188 ---DHYYQE 193
               |||.||
 Worm   313 RPGDHYCQE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fngNP_524191.1 Fringe 145..394 CDD:190308 17/80 (21%)
Y19D10A.16NP_001041189.1 galactose_mutarotase_like 6..326 CDD:185696 41/204 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.