DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fng and MFNG

DIOPT Version :9

Sequence 1:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_002396.2 Gene:MFNG / 4242 HGNCID:7038 Length:321 Species:Homo sapiens


Alignment Length:289 Identity:131/289 - (45%)
Similarity:176/289 - (60%) Gaps:9/289 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DLSQRAVTATPQ-------PPVTELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTD 187
            :||.:.|..||:       ||..:|.|:||:||||:.:|..||.|::.||....|:||:.|||:.
Human    29 NLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSP 93

  Fly   188 DHYYQEKTKGHLINTKCSQGHFRKALCCKMSAELDVFLESGKKWFCHFDDDNYVNVPRLVKLLDE 252
            |...||:...||:.|.||..|...||.|||:||.|.||.||.:||||.|||||||...|::||..
Human    94 DKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRA 158

  Fly   253 YSPSVDWYLGKPSISSPLEIHLDSKNTTTNKKITFWFATGGAGFCLSRALTLKMLPIAGGGKFIS 317
            :..:.|.|:|:||::.|:.......:..| :.:.|||||||||||::|.|.|||.|.|.|.:|:.
Human   159 FPLARDVYVGRPSLNRPIHASEPQPHNRT-RLVQFWFATGGAGFCINRKLALKMAPWASGSRFMD 222

  Fly   318 IGDKIRFPDDVTMGFIIEHLLKVPLTVVDNFHSHLEPMEFIRQDTFQDQVSFSYAHMKNQWNVIK 382
            ....||.|||.|||:|||..|...|.....||||||.::.:|.....:||:.||...:.:.||||
Human   223 TSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIK 287

  Fly   383 VDG-FDMKTDPKRFYSLHCQLFPYFSFCP 410
            :.| |..:.||.||.||||.|:|...:||
Human   288 LQGPFSPEEDPSRFRSLHCLLYPDTPWCP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fngNP_524191.1 Fringe 145..394 CDD:190308 114/249 (46%)
MFNGNP_002396.2 Fringe 51..300 CDD:190308 114/249 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155106
Domainoid 1 1.000 245 1.000 Domainoid score I2181
eggNOG 1 0.900 - - E1_2C9I6
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 270 1.000 Inparanoid score I3011
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47481
OrthoDB 1 1.010 - - D356445at33208
OrthoFinder 1 1.000 - - FOG0002392
OrthoInspector 1 1.000 - - otm41898
orthoMCL 1 0.900 - - OOG6_104952
Panther 1 1.100 - - O PTHR10811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1586
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.