DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fng and LFNG

DIOPT Version :9

Sequence 1:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001035257.1 Gene:LFNG / 3955 HGNCID:6560 Length:379 Species:Homo sapiens


Alignment Length:408 Identity:158/408 - (38%)
Similarity:227/408 - (55%) Gaps:47/408 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KRILQAMMLAVAVVYMTLLLYQSAYGYPGIQVPHSQ----VDALASEAVTTHRDQLLQDYVQSST 74
            ||..:.::||:|...:..||..:| ..|...:|..:    :.:||..|              .:.
Human     3 KRCGRRLLLALAGALLACLLVLTA-DPPPPPLPAERGRRALRSLAGPA--------------GAA 52

  Fly    75 PTQPGAGAPAASPTTVIIRKDIRSFN--FSDIEVSERPTATLLTELARRSRNGELLRDLSQRAVT 137
            |. ||.||.||:|..::  :|:.|.:  ||           |||   |..|:.......:.|...
Human    53 PA-PGLGAAAAAPGALV--RDVHSLSEYFS-----------LLT---RARRDAGPPPGAAPRPAD 100

  Fly   138 ATPQPPVTEL--DDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDDHYYQEKTKGHLI 200
            ..|:|....|  .|:||:|||||.:|..||.|:::||....::.|:.|||.:|......| |:::
Human   101 GHPRPLAEPLAPRDVFIAVKTTKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHT-GNVV 164

  Fly   201 NTKCSQGHFRKALCCKMSAELDVFLESGKKWFCHFDDDNYVNVPRLVKLLDEYSPSVDWYLGKPS 265
            .|.||..|.|:||.|||:.|.|.|:|||:|||||.|||||||:..|::||..|..:.|.|:||||
Human   165 ITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPS 229

  Fly   266 ISSPLEIHLDSKNTTTNK--KITFWFATGGAGFCLSRALTLKMLPIAGGGKFISIGDKIRFPDDV 328
            :..|::.   .:..:.||  .:.|||||||||||:||.|.|||.|.|.||.|::..::||.|||.
Human   230 LDRPIQA---MERVSENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDC 291

  Fly   329 TMGFIIEHLLKVPLTVVDNFHSHLEPMEFIRQDTFQDQVSFSYAHMKNQWNVIKVDG-FDMKTDP 392
            |:|:|:|.||.|||.....||||||.::.:......:||:.||...:|:.|.:.|.| |.::.||
Human   292 TIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADP 356

  Fly   393 KRFYSLHCQLFPYFSFCP 410
            .||.|:||.|:|...:||
Human   357 SRFRSIHCHLYPDTPWCP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fngNP_524191.1 Fringe 145..394 CDD:190308 116/253 (46%)
LFNGNP_001035257.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..107 4/20 (20%)
Fringe 110..358 CDD:190308 116/251 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155107
Domainoid 1 1.000 245 1.000 Domainoid score I2181
eggNOG 1 0.900 - - E1_2C9I6
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 270 1.000 Inparanoid score I3011
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47481
OrthoDB 1 1.010 - - D356445at33208
OrthoFinder 1 1.000 - - FOG0002392
OrthoInspector 1 1.000 - - otm41898
orthoMCL 1 0.900 - - OOG6_104952
Panther 1 1.100 - - O PTHR10811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4573
SonicParanoid 1 1.000 - - X1586
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.