powered by:
Protein Alignment fng and AT4G00300
DIOPT Version :9
Sequence 1: | NP_524191.1 |
Gene: | fng / 40314 |
FlyBaseID: | FBgn0011591 |
Length: | 412 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001190642.1 |
Gene: | AT4G00300 / 28719430 |
AraportID: | AT4G00300 |
Length: | 478 |
Species: | Arabidopsis thaliana |
Alignment Length: | 50 |
Identity: | 14/50 - (28%) |
Similarity: | 22/50 - (44%) |
Gaps: | 8/50 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 233 CHFDDDNYVNVPRLVKLLDEYSPSVDWYLGKPSISSPLEIHLDSKNTTTN 282
|..|.|:.|:..|.|. |..|.:|.::..:.||: |..:|...|
plant 35 CGSDVDSTVDNRRFVG--DASSSNVQFFSSEGSIA------LKGENLPQN 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10811 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.