DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fng and ZC250.2

DIOPT Version :9

Sequence 1:NP_524191.1 Gene:fng / 40314 FlyBaseID:FBgn0011591 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_504520.2 Gene:ZC250.2 / 178968 WormBaseID:WBGene00022576 Length:449 Species:Caenorhabditis elegans


Alignment Length:258 Identity:59/258 - (22%)
Similarity:106/258 - (41%) Gaps:50/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 DIFISVKTTKNYHDTRLALIIKTWFQLARD--QTWFFTDTDDHYYQEKTKGHLINTKCSQGHFRK 211
            ::.:.|||.:.:|..||.::..||   |.|  :..:.:|.:|........| :.||  .:||   
 Worm   226 EVHVMVKTFEGHHVNRLEVLKNTW---ASDVSRIEYCSDKEDPAIPTINLG-VDNT--DRGH--- 281

  Fly   212 ALCCKMSAELDVFLES---GKKWFCHFDDDNYVNVPRLVKLLDEYSPSVDWYLGKPSISSPLEIH 273
              |.|.......||.|   |.||....|||..:|..||.::|:.|.......:|: .......::
 Worm   282 --CAKTWEIFRRFLGSSGNGAKWLVVADDDTLMNFKRLKQMLELYDSGDKIIIGE-RYGYGFSLN 343

  Fly   274 LDSKNTTTNKKITFWFATGGAGFCLSRALTLKMLPIAGGGKFISIGDKIRFPDDVTMGFIIEHLL 338
            .||         .:.:.|||:|...:|:....:|  |.....|:..|    |||:|:| |.....
 Worm   344 GDS---------GYDYPTGGSGMIFTRSAVESLL--AQCPSCIANTD----PDDMTIG-ICALTA 392

  Fly   339 KVPLTVVDNFHSHLEPMEF----------IRQDTFQDQVSFSYAHMKNQWNVIKVDGFDMKTD 391
            .:|:......| ...|:::          ..:.|..|.:|..|.::      ::::.::.|::
 Worm   393 GIPIVHESRLH-QARPLDYAPEYIKYPISFHKFTDIDPISVYYEYL------VELEEYNHKSE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fngNP_524191.1 Fringe 145..394 CDD:190308 59/258 (23%)
ZC250.2NP_504520.2 Galactosyl_T 231..424 CDD:304462 54/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5673
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.