DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tlr8b and Fili

DIOPT Version :9

Sequence 1:NP_001373638.1 Gene:tlr8b / 403136 ZFINID:ZDB-GENE-040219-12 Length:1015 Species:Danio rerio
Sequence 2:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster


Alignment Length:590 Identity:135/590 - (22%)
Similarity:217/590 - (36%) Gaps:141/590 - (23%)


- Green bases have known domain annotations that are detailed below.


Zfish   449 PPFTKAECLATGPVLDLSRNNIYHVNPPLFTGAENITCLNLSSNFIVSYFNGTEFAHFPKLKYLD 513
            |.:.|.|      :||||:|.|..:....|.....:..||||.| :||..:...|.....|..||
  Fly    93 PFYMKLE------ILDLSQNIIETLGSKNFEYQSELRTLNLSRN-LVSSLHKHAFKGLTNLLLLD 150

Zfish   514 LSHNRIYMHSDSALSELKALEVLDLSHN------QHYFEVAGVRNCLTFLEN------------L 560
            ||.|||.....:|||:|.:|..|||::|      .:.|:.......|.|..|            |
  Fly   151 LSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHL 215

Zfish   561 QFLKVLNLSWNEINMLTNKTLQS-DSLNELQFQGN---RLDIMWKKQRGYQSLFKSLSNLTYLDI 621
            ..||.|::|.|.:..:.|.:.:. ..|..|..|||   .||:         |.|:.|.:|.:||:
  Fly   216 HALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDL---------SAFEGLISLKHLDL 271

Zfish   622 SYNKLSEIPDDIFDYFPKTLRYISMSRNTLTDFAWEQLQSLPQLETLDLSKNKL--RVVPRKLSK 684
            |.|.|:.:|....... ..|.|:::..|..:........:|..|..|.||:...  |:..|....
  Fly   272 SDNNLTMVPTQQLSKL-SNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVD 335

Zfish   685 HTRSLKVLDLSHN-QISKLRYSFLENVKSLQILNFANNKLKHLGASSFTTGSNHQLQILDLQRNP 748
            :|. |:.|.|::| |:|.:.....:...::..:...:|.|:.|.::.|..   .|||.|.|..||
  Fly   336 NTH-LQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPV---DQLQKLYLGDNP 396

Zfish   749 IHCTCNLLDFILWL--------EKSDTILPRLATDVLCDLPESKRGHPMVSLDFKNACINNSIAE 805
            :.|.|:|    |||        |..|..:...|...:..|.:......:.......|..::.:|.
  Fly   397 LQCNCSL----LWLWRLVTGNFEGVDPGMEHAAGGAVAALAKEADDEELADEATAVASTDDGVAA 457

Zfish   806 ILYILTSSVITLVMCTTIGIHVFYWDISYAYNFCMARFKSYYLKTNDCIYDAFVMYDTKDPMVAE 870
            :...:....|...:.||                   ...:|.|.|:....::.:           
  Fly   458 LAAYIAEQHIVNALHTT-------------------EPSAYELATSSSNRNSGI----------- 492

Zfish   871 WVLNHLRLELEDRGRHVRPLCLEERDWTPGIPIMDNLNLSVHRSRKTIFVLTEGFV----HSGIF 931
                 ||::.:..|..:         |...:           |:|:.:..::||.:    |....
  Fly   493 -----LRMDRQQIGCDI---------WRDKV-----------RTRRKLLTMSEGEITCPAHIVTV 532

Zfish   932 KMAAFLAQQRLLEEGVDVMVLVLLEPVLRQSRILNLR--------------RCLCGHSVLEWPRN 982
            ..|....   ||...:.:.||..|..|.|:.::|:.|              |.|.||       |
  Fly   533 VCAVITC---LLVAMIGISVLYYLRFVKRRRKLLHERGPMRTSKSIINVHDRILQGH-------N 587

Zfish   983 PAAEG 987
            |...|
  Fly   588 PGGLG 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tlr8bNP_001373638.1 leucine-rich repeat 36..57 CDD:275380
leucine-rich repeat 58..78 CDD:275380
LRR_8 64..116 CDD:404697
leucine-rich repeat 79..105 CDD:275380
leucine-rich repeat 106..121 CDD:275380
LRR_8 126..190 CDD:404697
leucine-rich repeat 127..150 CDD:275380
leucine-rich repeat 151..179 CDD:275380
PLN00113 180..>735 CDD:215061 84/310 (27%)
leucine-rich repeat 180..224 CDD:275380
leucine-rich repeat 225..266 CDD:275380
leucine-rich repeat 267..290 CDD:275380
leucine-rich repeat 347..373 CDD:275380
leucine-rich repeat 374..397 CDD:275380
leucine-rich repeat 462..483 CDD:275380 7/20 (35%)
leucine-rich repeat 484..508 CDD:275380 8/23 (35%)
leucine-rich repeat 509..532 CDD:275380 12/22 (55%)
leucine-rich repeat 563..615 CDD:275380 16/55 (29%)
leucine-rich repeat 586..607 CDD:275380 7/23 (30%)
leucine-rich repeat 616..640 CDD:275380 7/23 (30%)
leucine-rich repeat 641..664 CDD:275380 4/22 (18%)
leucine-rich repeat 665..688 CDD:275380 7/24 (29%)
leucine-rich repeat 689..712 CDD:275380 6/23 (26%)
leucine-rich repeat 713..732 CDD:275380 3/18 (17%)
LRRCT 747..795 CDD:214507 12/55 (22%)
TIR 855..997 CDD:214587 26/151 (17%)
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 1/3 (33%)
leucine-rich repeat 98..121 CDD:275380 8/28 (29%)
LRR_8 120..180 CDD:404697 25/60 (42%)
leucine-rich repeat 122..145 CDD:275380 8/23 (35%)
leucine-rich repeat 146..169 CDD:275380 12/22 (55%)
LRR <161..>354 CDD:227223 54/203 (27%)
leucine-rich repeat 170..193 CDD:275380 6/22 (27%)
leucine-rich repeat 194..217 CDD:275380 4/22 (18%)
leucine-rich repeat 218..265 CDD:275380 16/55 (29%)
leucine-rich repeat 266..289 CDD:275380 7/23 (30%)
leucine-rich repeat 290..313 CDD:275380 4/22 (18%)
leucine-rich repeat 314..338 CDD:275380 6/23 (26%)
LRR_8 337..397 CDD:404697 17/63 (27%)
leucine-rich repeat 339..360 CDD:275380 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.