Sequence 1: | NP_649266.1 | Gene: | CG32432 / 40310 | FlyBaseID: | FBgn0052432 | Length: | 1307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005128.1 | Gene: | DGCR2 / 9993 | HGNCID: | 2845 | Length: | 550 | Species: | Homo sapiens |
Alignment Length: | 265 | Identity: | 59/265 - (22%) |
---|---|---|---|
Similarity: | 90/265 - (33%) | Gaps: | 93/265 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 214 CSLAEFSCSNG--RCVPLSKYCNNLNDCGDGSDEPRFCTRCNRTYYGDIGQTYALELHRPKQDRV 276
Fly 277 PFVCVLTFTAAGG--QHGDVVQVTLDSFTIGRFTSYVHEGCPDG---YMQIAESARTPIGG--MW 334
Fly 335 -----CGSSWGPVLFYSETRSLIFTIRLNRLA------------RDQ-----------SGYNFDF 371
Fly 372 RIRYKVLSRDSSVT--------------------------RYGGIKLAELAQWH-----NRSSFL 405
Fly 406 NQQQQ 410 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32432 | NP_649266.1 | LDLa | 214..245 | CDD:197566 | 11/32 (34%) |
CUB | 503..646 | CDD:238001 | |||
LDLa | 1203..1231 | CDD:197566 | |||
DGCR2 | NP_005128.1 | LDLa | 30..66 | CDD:238060 | 13/36 (36%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 69..92 | 6/36 (17%) | |||
CLECT_DGCR2_like | 115..267 | CDD:153069 | 30/156 (19%) | ||
VWC | 271..329 | CDD:214564 | |||
Atrophin-1 | <428..537 | CDD:331285 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 500..550 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1215 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |