DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32432 and Lrp3

DIOPT Version :9

Sequence 1:NP_649266.1 Gene:CG32432 / 40310 FlyBaseID:FBgn0052432 Length:1307 Species:Drosophila melanogaster
Sequence 2:XP_038948896.1 Gene:Lrp3 / 89787 RGDID:619729 Length:810 Species:Rattus norvegicus


Alignment Length:57 Identity:23/57 - (40%)
Similarity:30/57 - (52%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 SISSSLGPGKPVNLQLAPGS-SSTGCSLAEFSCSNGRCVPLSKYCNNLNDCGDGSDE 245
            |.:||.|..:...|....|. ....|...||.|.||:|:|....||.:::|||||||
  Rat   141 SDASSSGQAQGFRLSYIRGKLGQASCQTDEFRCDNGKCLPGPWQCNMVDECGDGSDE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32432NP_649266.1 LDLa 214..245 CDD:197566 15/30 (50%)
CUB 503..646 CDD:238001
LDLa 1203..1231 CDD:197566
Lrp3XP_038948896.1 CUB 43..156 CDD:238001 5/14 (36%)
LDLa 166..200 CDD:238060 17/32 (53%)
LDLa 212..249 CDD:238060
CUB 254..364 CDD:238001
LDLa 416..452 CDD:238060
LDLa 455..489 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1215
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.